PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Do024960.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Dichantheliinae; Dichanthelium
Family Dof
Protein Properties Length: 289aa    MW: 28881.6 Da    PI: 9.0774
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Do024960.1genomeDichanView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof113.97.1e-3676131560
      zf-Dof   5 alkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkk 60 
                   +cprC s++tkfCyynny++sqPr+fC+aCrryWt GG+lrnvP+Gg++rk+ +
  Do024960.1  76 GEQCPRCASHDTKFCYYNNYNTSQPRHFCRACRRYWTLGGSLRNVPIGGSTRKRPR 131
                 579*************************************************9865 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF027013.2E-3177129IPR003851Zinc finger, Dof-type
PROSITE profilePS5088427.55977131IPR003851Zinc finger, Dof-type
ProDomPD0074782.0E-2179124IPR003851Zinc finger, Dof-type
PROSITE patternPS01361079115IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 289 aa     Download sequence    Send to blast
MPPFAPLPPT CKNDLHHFAT PTTTAAMATS GSNLTPATAA AADMAAYLQQ LQDTAAANAA  60
AEASKQSGGG GGAARGEQCP RCASHDTKFC YYNNYNTSQP RHFCRACRRY WTLGGSLRNV  120
PIGGSTRKRP RLAHHHHPPA ARRSPVFGLG LGGGAPPMSV PPLPSSSSQG GGLLGSLFAL  180
GAAAPLLEGR GAGVGFDLGL GLHAGGPLGG GGEVGVQMQG LGLRGSGSAA GAAGASSGLF  240
WPAGLLDNDS VDTWKMLPGA GVGAAMWPEF AAAAAPQTGG LLHGGVQLM
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKC5824061e-94KC582406.1 Sorghum bicolor dof9 protein (dof9) gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008644658.18e-94PREDICTED: dof zinc finger protein DOF3.4-like
TrEMBLA0A096QUP88e-94A0A096QUP8_MAIZE; Uncharacterized protein
STRINGGRMZM2G061292_P012e-93(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP14037367
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G51700.16e-25DOF zinc finger protein 1